LP design by Saladament Kouso MAKER (20g x 14 sachets)
View PC page
View SP page
LP design by Saladament Kouso MAKER (20g x 14 sachets)LP information
- Registration date 2018-01-25
- https://store.shopping.yahoo.co.jp/luire/SMKSM1-000500.html
- Product/service name
- Saladament Kouso MAKER (20g x 14 sachets)
- Categories
- Health and Beauty Foods and Supplements
- Company name
- Luire Konbienience Shop（Takamatsu City, Kagawa Prefecture）
- Color
- We design LPs using Beige tones
- Image
- These LPs have a "Trust and Safety" style design
- Catchcopy
- One sachet instead of breakfast! Aim for -3kg while eating!
- Site Description
- Plu Official Shop PayPay Mall Store | Free shipping diet | Saladament Kouso MAKER (20g x 14 sachets) | Jelly supplement edible enzyme
CosmeticscosmeticbeautymakeupskincareLuire Konbienience Shopfree shipping edible enzyme [Saladament Kouso MAKER (20g x 14 sachets)]jellymini-fastingmakerfastingraw enzymeenzyme supplementplant-fermented foodmail order siteonline shopping
【Note】 The landing page shown above was not designed by our company.
※You can view our production portfoliohere.
Clicking the design opens the source website.
*The original site may have been modified or removed.
